ThreatFox IOC Database
You are viewing the ThreatFox database entry for domain cizgifilmlervekarakterhikayeleri.xyz.
Database Entry
This IOC expired
This IOC is an old IOC and hence has expired on 2026-09-15 10:39:25 UTC. We therefore refrain from exporting it into our datasets. As a result, this database entry is purely informational and has no impact.
| IOC ID: | 1346964 |
|---|---|
| IOC: | cizgifilmlervekarakterhikayeleri.xyz |
| IOC Type : | domain |
| Threat Type : | botnet_cc |
| Malware: | Coper |
| Malware alias: | ExobotCompact, Octo |
| Confidence Level : | Confidence level is high (100%) |
| Is compromised? : | False |
| First seen: | 2024-11-23 07:22:18 UTC |
| Last seen: | never |
| UUID: | ac40ae4c-a96b-11ef-91ae-42010aa4000a |
| Reporter | |
| Reward | 5 credits from ThreatFox |
| Tags: | Coper Octo Octo2 |