🤲🏼 NEW | abuse.ch Community Hub! Earn recognition 🏅 for the malware intelligence you share, climb the leaderboards 📈, and connect with like-minded contributors who share your hunting focus 🤝. Ready to unlock your profile? Go to the Community Hub →

ThreatFox IOC Database

You are viewing the ThreatFox database entry for domain cizgifilmlervekarakterhikayeleri.xyz.

Database Entry


IOC ID:1346964
IOC: cizgifilmlervekarakterhikayeleri.xyz
IOC Type :domain
Threat Type :botnet_cc
Malware: Coper
Malware alias:ExobotCompact, Octo
Confidence Level : Confidence level is high (100%)
Is compromised? : False
First seen:2024-11-23 07:22:18 UTC
Last seen:never
UUID:ac40ae4c-a96b-11ef-91ae-42010aa4000a
Reporter NDA0E
Reward 5 credits from ThreatFox
Tags:Coper Octo Octo2